Structure of PDB 6kdq Chain B Binding Site BS01

Receptor Information

>6kdq Chain B (length=226) Species: 9606 (Homo sapiens)

GSHMTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRK
FLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFL
VQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLA
EFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSA
GLSLLAEERQENLPDEIYHVYSFALR

Ligand information

>6kdq Chain F (length=7) Species: 9606 (Homo sapiens)

GPRRRSR

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6kdq Substrate engagement regulates state-specific alpha-N methylation of CENP-A by NRMT2
• Resolution: 1.499 Å
• Binding residue (original residue number in PDB): Y19 W20 L31 W136 N168 D180 D212 E213 I214 Y215
• Binding residue (residue number reindexed from 1): Y22 W23 L34 W139 N171 D183 D215 E216 I217 Y218

Enzymatic activity

• Enzyme Commision number: 2.1.1.244: protein N-terminal methyltransferase.

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008276 protein methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0071885 N-terminal protein N-methyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006480 N-terminal protein amino acid methylation
• GO:0007051 spindle organization
• GO:0007059 chromosome segregation
• GO:0018012 N-terminal peptidyl-alanine trimethylation
• GO:0018013 N-terminal peptidyl-glycine methylation
• GO:0018016 N-terminal peptidyl-proline dimethylation
• GO:0032259 methylation
• GO:0035572 N-terminal peptidyl-serine dimethylation
• GO:0035573 N-terminal peptidyl-serine trimethylation

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6kdq, PDBe:6kdq, PDBj:6kdq
• PDBsum: 6kdq
• UniProt: Q9BV86|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 (Gene Name=NTMT1)