Structure of PDB 6kd5 Chain B Binding Site BS01

Receptor Information
>6kd5 Chain B (length=238) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKV
LEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRLSKPLT
LSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLI
DFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYL
AGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMEVRSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kd5 Crystal structure of inhibitor-bound human MSPL that can activate high pathogenic avian influenza.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		H366 Y406 D408 D411 D505 S506 Q508 S511 S530 W531 G532 G534
Binding residue
(residue number reindexed from 1)		H41 Y81 D83 D86 D180 S181 Q183 S186 S205 W206 G207 G209
Enzymatic activity
Catalytic site (original residue number in PDB) H366 D414 Q508 G509 D510 S511
Catalytic site (residue number reindexed from 1) H41 D89 Q183 G184 D185 S186
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6kd5, PDBe:6kd5, PDBj:6kd5
PDBsum6kd5
PubMed33820827
UniProtQ9BYE2|TMPSD_HUMAN Transmembrane protease serine 13 (Gene Name=TMPRSS13)

[Back to BioLiP]