Structure of PDB 6kbs Chain B Binding Site BS01

Receptor Information

>6kbs Chain B (length=227) Species: 562 (Escherichia coli)

CGRFAQSQTREDYLALLAEDIERDIPYDPEPIGRYNVAPGTKVLLLSERD
EHLHLDPVFWGYAPGWWDKPPLINARVETAATSRMFKPLWQHGRAICFAD
GWFEWKKEGDKKQPFFIYRADGQPIFMAAIGSTPFERGDEAEGFLIVTAA
ADQGLVDIHDRRPLVLSPEAAREWMRQEISGKEASEIAASGCVPANQFSW
HPVSRAVGNVKNQGAELIQPVLEVLFQ

Ligand information

>6kbs Chain D (length=9)

ggtcgattc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6kbs Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.
• Resolution: 1.601 Å
• Binding residue (original residue number in PDB): G3 R4 P40 W67 W68 K70 L73 N75 R77 S84 R85 M86 F87 W106 K113 T149 H160 R162 G209
• Binding residue (residue number reindexed from 1): G2 R3 P39 W66 W67 K69 L72 N74 R76 S83 R84 M85 F86 W105 K112 T148 H159 R161 G208
• Binding affinity: PDBbind-CN: Kd=2.2uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 02:41:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6kbs', asym_id = 'B', bs = 'BS01', title = 'Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6kbs', asym_id='B', bs='BS01', title='Molecular basis of abasic site sensing in single-stranded DNA by the SRAP domain of E. coli yedK.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003697,0006974,0106300', uniprot = '', pdbid = '6kbs', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003697,0006974,0106300', uniprot='', pdbid='6kbs', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>