Structure of PDB 6k59 Chain B Binding Site BS01

Receptor Information
>6k59 Chain B (length=32) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
Ligand information
>6k59 Chain A (length=21) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k59 Molecular Details of a Salt Bridge and Its Role in Insulin Fibrillation by NMR and Raman Spectroscopic Analysis.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 N3 H5 C7 L11 C19 R22 F24 Y26 P28 K29 R31
Binding residue
(residue number reindexed from 1)		F1 N3 H5 C7 L11 C19 R22 F24 Y26 P28 K29 R31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6k59, PDBe:6k59, PDBj:6k59
PDBsum6k59
PubMed31958230
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]