Structure of PDB 6jzd Chain B Binding Site BS01

Receptor Information
>6jzd Chain B (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jzd Structural basis of tubulin detyrosination by VASH2/SVBP heterodimer.
Resolution2.479 Å
Binding residue
(original residue number in PDB)		Q53 F54 F57
Binding residue
(residue number reindexed from 1)		Q28 F29 F32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0016504 peptidase activator activity
Biological Process
GO:0006508 proteolysis
GO:0009306 protein secretion
GO:0010596 negative regulation of endothelial cell migration
GO:0031397 negative regulation of protein ubiquitination
GO:0061564 axon development
GO:1905048 regulation of metallopeptidase activity
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jzd, PDBe:6jzd, PDBj:6jzd
PDBsum6jzd
PubMed31324789
UniProtQ8N300|SVBP_HUMAN Small vasohibin-binding protein (Gene Name=SVBP)

[Back to BioLiP]