Structure of PDB 6jx3 Chain B Binding Site BS01

Receptor Information
>6jx3 Chain B (length=85) Species: 2021 (Thermobifida fusca) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEFRLRPEISVAQTDYGMVLLDGRSGEYWQLNDTAALIVQRLLDGHSPAD
VAQFLTSEYEVERTDAERDIAALVTSLKENGMALP
Ligand information
>6jx3 Chain A (length=18) Species: 2021 (Thermobifida fusca) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKKYTAPQLAKVGEFKEA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jx3 Structural Basis of Leader Peptide Recognition in Lasso Peptide Biosynthesis Pathway.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		G31 E32 Y33 W34 Q35 L36 N37 T39 A40 T61 S62 E63 Y64 E65 V66 D74 M87
Binding residue
(residue number reindexed from 1)		G26 E27 Y28 W29 Q30 L31 N32 T34 A35 T56 S57 E58 Y59 E60 V61 D69 M82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6jx3, PDBe:6jx3, PDBj:6jx3
PDBsum6jx3
PubMed31188556
UniProtQ47QT5

[Back to BioLiP]