Structure of PDB 6jpi Chain B Binding Site BS01

Receptor Information
>6jpi Chain B (length=93) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADM
AIRLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jpi Crystal structure of PA4674 in complex with its operator DNA (28bp) from Pseudomonas aeruginosa
Resolution3.143 Å
Binding residue
(original residue number in PDB)
A28 R32 A38 P39 N42 R46
Binding residue
(residue number reindexed from 1)
A23 R27 A33 P34 N37 R41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6jpi, PDBe:6jpi, PDBj:6jpi
PDBsum6jpi
PubMed
UniProtQ9HVC1

[Back to BioLiP]