Structure of PDB 6jm9 Chain B Binding Site BS01

Receptor Information
>6jm9 Chain B (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAV
TYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6jm9 Chain I (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacctgcagattctaccaaaagtgtatttggaaactgctccatcaaaagg
catgttcagctgaattcagctgaacatgccttttgatggagcagtttcca
aatacacttttggtagaatctgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jm9 Structural basis of recognition and destabilization of the histone H2B ubiquitinated nucleosome by the DOT1L histone H3 Lys79 methyltransferase.
Resolution7.3 Å
Binding residue
(original residue number in PDB)		R23 P32 R36 R45 K77
Binding residue
(residue number reindexed from 1)		R3 P12 R16 R25 K57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6jm9, PDBe:6jm9, PDBj:6jm9
PDBsum6jm9
PubMed30923167
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]