Structure of PDB 6jbx Chain B Binding Site BS01

Receptor Information
>6jbx Chain B (length=143) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIGKAPDVT
PSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRL
IHRLHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jbx Structural insights into repression of the Pneumococcal fatty acid synthesis pathway by repressor FabT and co-repressor acyl-ACP.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		P51 S52 L62 G63 T66 R80 R88 V89 V90
Binding residue
(residue number reindexed from 1)		P51 S52 L62 G63 T66 R80 R88 V89 V90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jbx, PDBe:6jbx, PDBj:6jbx
PDBsum6jbx
PubMed31291684
UniProtQ8DR18

[Back to BioLiP]