Structure of PDB 6j9l Chain B Binding Site BS01

Receptor Information
>6j9l Chain B (length=112) Species: 487 (Neisseria meningitidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNNIFNKYPTIIHGEARGENDEFVVHTRYPRFLARKSFDDNFTGEMPAKP
VNGELGQIGEPRRLAYDSRLGLWLSDFIMLDNNKPKNMEDWLGQLKAACD
RIAADDLMLNED
Ligand information
>6j9l Chain E (length=27) Species: 264 (Francisella tularensis subsp. novicida) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKDSYTLLMNNRTARRHQRRGIDRKQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9l Diverse Mechanisms of CRISPR-Cas9 Inhibition by Type IIC Anti-CRISPR Proteins.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		E18 F41 D42 D43 F45 T46 D109 N113 D115
Binding residue
(residue number reindexed from 1)		E15 F38 D39 D40 F42 T43 D106 N110 D112
Enzymatic activity
Enzyme Commision number ?
External links