Structure of PDB 6j80 Chain B Binding Site BS01

Receptor Information
>6j80 Chain B (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AASMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQ
PDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPG
LCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYE
FAPKKAASHRALDAISESIKELQFYRNNIFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j80 Structural insights into nanoRNA degradation by human Rexo2.
Resolution1.812 Å
Binding residue
(original residue number in PDB)		E49 M50 L53 W96 C97 H100 H101 S143 E146 F186 K189 K190
Binding residue
(residue number reindexed from 1)		E14 M15 L18 W61 C62 H65 H66 S108 E111 F151 K154 K155
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6j80, PDBe:6j80, PDBj:6j80
PDBsum6j80
PubMed30926754
UniProtQ9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]