Structure of PDB 6j7z Chain B Binding Site BS01

Receptor Information

>6j7z Chain B (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPD
ELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLC
PLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFA
PSHRALDAISESIKELQFYRNNIFKKK

Ligand information

>6j7z Chain C (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6j7z Structural insights into nanoRNA degradation by human Rexo2.
Resolution	2.005 Å
Binding residue (original residue number in PDB)	E49 M50 G52 L53 W96 C97 H101 S143 E146 S170
Binding residue (residue number reindexed from 1)	E12 M13 G15 L16 W59 C60 H64 S106 E109 S133

Enzymatic activity

Enzyme Commision number

3.1.15.-

Gene Ontology

	Molecular Function
GO:0000175	3'-5'-RNA exonuclease activity
GO:0003676	nucleic acid binding

View graph for
Molecular Function

External links

PDB	RCSB:6j7z, PDBe:6j7z, PDBj:6j7z
PDBsum	6j7z
PubMed	30926754
UniProt	Q9Y3B8\|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]