Structure of PDB 6j56 Chain B Binding Site BS01

Receptor Information
>6j56 Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQQRFFRIPFIRKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDME
MCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTY
ATAMLQS
Ligand information
>6j56 Chain D (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVTSEGKFDKFLEERAKAADRLPNLSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j56 Structure of Myosin VI/Tom1 complex reveals a cargo recognition mode of Myosin VI for tethering.
Resolution1.798 Å
Binding residue
(original residue number in PDB)		F1175 W1193 Q1205 E1207 H1209 D1211 K1212 P1213 E1225 C1227 L1229 E1233 T1234 R1238
Binding residue
(residue number reindexed from 1)		F10 W18 Q30 E32 H34 D36 K37 P38 E50 C52 L54 E58 T59 R63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6j56, PDBe:6j56, PDBj:6j56
PDBsum6j56
PubMed31371777
UniProtQ9UM54|MYO6_HUMAN Unconventional myosin-VI (Gene Name=MYO6)

[Back to BioLiP]