Structure of PDB 6j2p Chain B Binding Site BS01

Receptor Information
>6j2p Chain B (length=93) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQ
AGITGKEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREF
Ligand information
>6j2p Chain F (length=6) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j2p Structural basis for histone H3K4me3 recognition by the N-terminal domain of the PHD finger protein Spp1.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		D31 G33 L35 M36 V37 G38 C39 D40 W45 V61 F62
Binding residue
(residue number reindexed from 1)		D11 G13 L15 M16 V17 G18 C19 D20 W25 V41 F42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:6j2p, PDBe:6j2p, PDBj:6j2p
PDBsum6j2p
PubMed31253666
UniProtQ03012|SPP1_YEAST COMPASS component SPP1 (Gene Name=SPP1)

[Back to BioLiP]