Structure of PDB 6iy3 Chain B Binding Site BS01

Receptor Information
>6iy3 Chain B (length=83) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6iy3 Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaaaactgtgccgcagtcggccgacctgagggtcgccggggtctgcgg
ggggaccctctggaaagtgaaggataagtgacgagcggagacgggatggc
gaacagacacaaacacacaagaggtgaatgttaggactgttgcagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iy3 Mechanism of DNA translocation underlying chromatin remodelling by Snf2.
Resolution3.67 Å
Binding residue
(original residue number in PDB)		R35 R45 I46 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R16 R26 I27 R59 K60 T61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6iy3, PDBe:6iy3, PDBj:6iy3
PDBsum6iy3
PubMed30867599
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]