Structure of PDB 6iui Chain B Binding Site BS01

Receptor Information
>6iui Chain B (length=113) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFP
KRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPVDFQLLTQQVIQCAYD
IAKAAKQLVTITT
Ligand information
>6iui Chain C (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SATRELDELMASLSDFKFMAQG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iui Structural basis of the target-binding mode of the G protein-coupled receptor kinase-interacting protein in the regulation of focal adhesion dynamics.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L669 A672 Q673 Q740 Q744 I747 Q748 Y751 K755 K758
Binding residue
(residue number reindexed from 1)		L20 A23 Q24 Q88 Q92 I95 Q96 Y99 K103 K106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005096 GTPase activator activity
Biological Process
GO:0007420 brain development
GO:0032012 regulation of ARF protein signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6iui, PDBe:6iui, PDBj:6iui
PDBsum6iui
PubMed30737283
UniProtQ9Z272|GIT1_RAT ARF GTPase-activating protein GIT1 (Gene Name=Git1)

[Back to BioLiP]