Structure of PDB 6iud Chain B Binding Site BS01

Receptor Information

>6iud Chain B (length=264) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MMSEIIAVANQKGGVGKTTTAVNLAASLAVHEKKILLIDFDPQANATSSL
GFRRDKIDYDIYHVLIGRKQISQVILKTQMPFLDLVPSNLGLAGFEKTFY
DSQDENKRGELMLKNALESVVGLYDYIIIDSPPALGPLTINSLSAAHSVI
IPIQCEFFALEGTKLLLNTIRMLQKSTNPKLKIRGFLPTMHVPQLNLTKG
VLAELFKYFDSEFFRDSATGEYIMIPKSVKLAESPSFGKPILLYDIKSNG
SIAYQKLAQSILQG

Ligand information

>6iud Chain E (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tccctgtttcacgtggaacaccct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6iud Crystal structures of HpSoj-DNA complexes and the nucleoid-adaptor complex formation in chromosome segregation.
Resolution	2.506 Å
Binding residue (original residue number in PDB)	Q194 L195 N196
Binding residue (residue number reindexed from 1)	Q194 L195 N196

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:6iud, PDBe:6iud, PDBj:6iud
PDBsum	6iud
PubMed	30544248
UniProt	O25759

[Back to BioLiP]