Structure of PDB 6iod Chain B Binding Site BS01

Receptor Information
>6iod Chain B (length=197) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGAQDFVPHTADLAELAAAAGECRGCGLYRDATQAVFGAGGRSARIMMI
GEQPGDKEDLAGLPFVGPAGRLLDRALEAADIDRDALYVTNAVKHFKFTR
RIHKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQ
HRGEVLHVDPALVATVHPSSLLRGPKEERESAFAGLVDDLRVAADVR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iod Suicide inactivation of the uracil DNA glycosylase UdgX by covalent complex formation.
Resolution1.66 Å
Binding residue
(original residue number in PDB)		G55 P68 A69 H109 G140 A141 R153 V154 T155 V177 H178 S180 S181 L183 R184
Binding residue
(residue number reindexed from 1)		G55 P68 A69 H103 G134 A135 R147 V148 T149 V166 H167 S169 S170 L172 R173
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0004844 uracil DNA N-glycosylase activity
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0097506 deaminated base DNA N-glycosylase activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6iod, PDBe:6iod, PDBj:6iod
PDBsum6iod
PubMed31101915
UniProtI7F541

[Back to BioLiP]