Structure of PDB 6iit Chain B Binding Site BS01

Receptor Information
>6iit Chain B (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFF
GTHETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iit Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and a H3K36me2-containing histone peptide
Resolution2.1 Å
Binding residue
(original residue number in PDB)
K77 R78 K79
Binding residue
(residue number reindexed from 1)
K78 R79 K80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6iit, PDBe:6iit, PDBj:6iit
PDBsum6iit
PubMed
UniProtQ9Y3E1|HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 (Gene Name=HDGFL3)

[Back to BioLiP]