Structure of PDB 6ify Chain B Binding Site BS01

Receptor Information
>6ify Chain B (length=294) Species: 1308 (Streptococcus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYKLYIMTFQNAHFGSGTLDSSKLTFSADRIFSALVLEALKMGKLDAFLA
EANQDKFTLTDAFPFQFGPFLPKPIGYPKHQSVDVKEVRRQAKLSKKLQF
LALENVDDYLNGELFENEEHAVIDTVTKNQPHKDDNLYQVATTRFSNDTS
LYVIANESDLLNELMSSLQYSGLGGKRSSGFGRFELDIQNIPLELSDRLT
KNHSDKVMSLTTALPVDADLEEAMEDGHYLLTKSSGFAFSHATNENYRKQ
DLYKFASGSTFSKTFEGQIVDVRPLDFPHAVLNYAKPLFFKLEV
Ligand information
>6ify Chain I (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacgcuuucuagcucgcuauaauuaccca
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ify Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution3.8 Å
Binding residue
(original residue number in PDB)		H14 G16 G18 T19 R31 S34 L41 L46 K133 N134 Q135 P136 L142 Y143 G180 R182 S240 G241 F242 A243 F244 N251 R253 K254 H284 A285 V286 L287 N288
Binding residue
(residue number reindexed from 1)		H13 G15 G17 T18 R30 S33 L40 L45 K128 N129 Q130 P131 L137 Y138 G175 R177 S235 G236 F237 A238 F239 N246 R248 K249 H279 A280 V281 L282 N283
External links