Structure of PDB 6ifr Chain B Binding Site BS01

Receptor Information
>6ifr Chain B (length=288) Species: 767463 (Streptococcus thermophilus ND03) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYKLYIMTFQNAHFGSGTLDSSKLTFSADRIFSALVLEALKMGKLDAFLA
EANQDKFTLTDAFPFQFGPFLPKPIGYPKDVKEVRRQAKLSKKLQFLALE
NVDDYLNGELFENEEHAVIDTVTKNQPHKDDNLYQVATTRFSNDTSLYVI
ANESDLLNELMSSLQYSGLGGKRSSGFGRFELDIQNIPLELSDRLTKNHS
DKVMSLTTALPVDADLEEAMEDGHYLLTKSSGFAFSHATNENYRKQDLYK
FASGSTFSKTFEGQIVDVRPLDFPHAVLNYAKPLFFKL
Ligand information
>6ifr Chain N (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacgcuuucuagcucgcuauaauuacccau
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifr Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution3.4 Å
Binding residue
(original residue number in PDB)		H14 G16 S17 G18 D30 R31 F33 S34 A35 V37 L38 T132 K133 N134 Q135 P136 N141 L142 Y143 G179 K181 R182 S183 S240 G241 F242 A243 F244 N251 K254 H284 A285 V286 L287
Binding residue
(residue number reindexed from 1)		H13 G15 S16 G17 D29 R30 F32 S33 A34 V36 L37 T123 K124 N125 Q126 P127 N132 L133 Y134 G170 K172 R173 S174 S231 G232 F233 A234 F235 N242 K245 H275 A276 V277 L278
External links