Structure of PDB 6ifn Chain B Binding Site BS01

Receptor Information
>6ifn Chain B (length=297) Species: 767463 (Streptococcus thermophilus ND03) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TYKLYIMTFQNAHFGSGTLDSSKLTFSADRIFSALVLEALKMGKLDAFLA
EANQDKFTLTDAFPFQFGPFLPKPIGYPKHDQIDQSVDVKEVRRQAKLSK
KLQFLALENVDDYLNGELFENEEHAVIDTVTKNQPHKDDNLYQVATTRFS
NDTSLYVIANESDLLNELMSSLQYSGLGGKRSSGFGRFELDIQNIPLELS
DRLTKNHSDKVMSLTTALPVDADLEEAMEDGHYLLTKSSGFAFSHATNEN
YRKQDLYKFASGSTFSKTFEGQIVDVRPLDFPHAVLNYAKPLFFKLE
Ligand information
>6ifn Chain N (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacgcuuucuagcucgcuauaauuacc
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifn Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H14 G16 G18 R31 S34 A35 V37 L38 L41 T132 K133 N134 Q135 P136 N141 L142 Y143 L178 G179 G180 K181 R182 S240 F242 A243 F244 N251 R253 K254 H284 A285 L287
Binding residue
(residue number reindexed from 1)		H13 G15 G17 R30 S33 A34 V36 L37 L40 T131 K132 N133 Q134 P135 N140 L141 Y142 L177 G178 G179 K180 R181 S239 F241 A242 F243 N250 R252 K253 H283 A284 L286
External links