Structure of PDB 6ic8 Chain B Binding Site BS01

Receptor Information
>6ic8 Chain B (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFIWKGFINMPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRISPQTVW
DYVEKIKASGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAANNM
KQVKDMYLIPLGATDKIPHPLVPFDGPGLELHRPNLLLGLIIRQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ic8 PHF3 regulates neuronal gene expression through the new Pol II CTD reader domain SPOC
Resolution1.929 Å
Binding residue
(original residue number in PDB)		G1246 G1247 R1248 Y1257 K1267 K1309 D1310
Binding residue
(residue number reindexed from 1)		G41 G42 R43 Y52 K62 K104 D105
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ic8, PDBe:6ic8, PDBj:6ic8
PDBsum6ic8
PubMed
UniProtQ92576|PHF3_HUMAN PHD finger protein 3 (Gene Name=PHF3)

[Back to BioLiP]