Structure of PDB 6i52 Chain B Binding Site BS01

Receptor Information
>6i52 Chain B (length=132) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNTRVNTLTPVTIKQILESKQDIQDGPFVSHNQELHHVCFVGVVRNITDH
TANIFLTIEDGTGQIEVRKWSEDAAQQFEIGGYVKVFGALKEFGGKKNIQ
YAVIKPIDSFNEVLTHHLEVIKCHSIASGMMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i52 A structural and dynamic model for the assembly of Replication Protein A on single-stranded DNA.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		T32 R99 F143 G144 K146 N148 Q150
Binding residue
(residue number reindexed from 1)		T1 R68 F93 G94 K96 N98 Q100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6i52, PDBe:6i52, PDBj:6i52
PDBsum6i52
PubMed30575763
UniProtP26754|RFA2_YEAST Replication factor A protein 2 (Gene Name=RFA2)

[Back to BioLiP]