Structure of PDB 6hpj Chain B Binding Site BS01

Receptor Information
>6hpj Chain B (length=84) Species: 1320,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFSKYGAIRDIDLKNRRGGPP
FAFVEFEDPRDAEDAVSGRDGYDYDGYRLRVEFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hpj Structure of SRSF1 RRM1 bound to RNA reveals an unexpected bimodal mode of interaction and explains its involvement in SMN1 exon7 splicing.
ResolutionN/A
Binding residue
(original residue number in PDB)		I7 R8 G9 P10 Y19 N22 L23 D46 K48 R50 G52 P55 F56 F58 R85
Binding residue
(residue number reindexed from 1)		I2 R3 G4 P5 Y14 N17 L18 D41 K43 R45 G47 P50 F51 F53 R80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:0005618 cell wall

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6hpj, PDBe:6hpj, PDBj:6hpj
PDBsum6hpj
PubMed33462199
UniProtP19909|SPG2_STRSG Immunoglobulin G-binding protein G (Gene Name=spg);
Q07955|SRSF1_HUMAN Serine/arginine-rich splicing factor 1 (Gene Name=SRSF1)

[Back to BioLiP]