Structure of PDB 6hpg Chain B Binding Site BS01

Receptor Information
>6hpg Chain B (length=117) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAF
LELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAAADFRHA
LVLEPQNKTAKVAEKRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hpg Phosphorylation of the outer membrane mitochondrial protein OM64 influences protein import into mitochondria.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
N496 Y499 Y511 N527 K557 L560 R561 T564 E586
Binding residue
(residue number reindexed from 1)
N14 Y17 Y29 N45 K75 L78 R79 T82 E104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6hpg, PDBe:6hpg, PDBj:6hpg
PDBsum6hpg
PubMed29374544
UniProtF4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial (Gene Name=OM64)

[Back to BioLiP]