Structure of PDB 6hip Chain B Binding Site BS01

Receptor Information
>6hip Chain B (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGA
PDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDL
AEQV
Ligand information
>6hip Chain C (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRRRWRERQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hip Modulation of HIV-1 gene expression by binding of a ULM motif in the Rev protein to UHM-containing splicing factors.
Resolution1.2 Å
Binding residue
(original residue number in PDB)		G316 V318 D319 E320
Binding residue
(residue number reindexed from 1)		G19 V21 D22 E23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0045292 mRNA cis splicing, via spliceosome

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6hip, PDBe:6hip, PDBj:6hip
PDBsum6hip
PubMed30892606
UniProtQ96I25|SPF45_HUMAN Splicing factor 45 (Gene Name=RBM17)

[Back to BioLiP]