Structure of PDB 6h9i Chain B Binding Site BS01

Receptor Information
>6h9i Chain B (length=250) Species: 76114 (Aromatoleum aromaticum EbN1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQQHLLRFALPAGKKLWPNDLREALAKHDLPPLFFSRDPQTGHAITRAMR
NEKRVRGYIEQHGHEPPPPTEEQRANPLAIPGIRIVGSSTWVGILATGER
YKPLLEAATLPAIQIVTQRCGRGVGVELEQHTLSIKGLDDPKRYFVRNLV
MKRGLTKTAENTTQVASRILSALERQAVAYSLDLPPTAQVDIHVESVVRP
RGMRLVTSTGATEQFVGLADVEFYACLDLKGYWFAGNLTSRGYGRIIADH
Ligand information
>6h9i Chain E (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgguguuccccgcgcaucgcgggg
........<<<<<<<...>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h9i Type IV CRISPR RNA processing and effector complex formation in Aromatoleum aromaticum.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		W18 R23 H44 A45 I46 T47 R48 A49 M50 R51 N52 R55 A80 S89 S90 F146 R148 N149 K153 R154 L156 K158 R176 R200 P201 R202 G203 M204 L206 T208 S209 T213 Q215 F216 G218 L219 D221 N238 L239 S241 R242 Y244 R246
Binding residue
(residue number reindexed from 1)		W17 R22 H43 A44 I45 T46 R47 A48 M49 R50 N51 R54 A79 S88 S89 F145 R147 N148 K152 R153 L155 K157 R175 R199 P200 R201 G202 M203 L205 T207 S208 T212 Q214 F215 G217 L218 D220 N237 L238 S240 R241 Y243 R245
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6h9i, PDBe:6h9i, PDBj:6h9i
PDBsum6h9i
PubMed30397343
UniProtQ5NWP0

[Back to BioLiP]