Structure of PDB 6h9h Chain B Binding Site BS01

Receptor Information
>6h9h Chain B (length=250) Species: 76114 (Aromatoleum aromaticum EbN1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQQHLLRFALPAGKKLWPNDLREALAKHDLPPLFFSRDPQTGHAITRAMR
NEKRVRGYIEQHGHEPPPPTEEQRANPLAIPGIRIVGSSTWVGILATGER
YKPLLEAATLPAIQIVTQRCGRGVGVELEQHTLSIKGLDDPKRYFVRNLV
MKRGLTKTAENTTQVASRILSALERQAVAYSLDLPPTAQVDIHVESVVRP
RGMRLVTSTGATEQFVGLADVEFYACLDLKGYWFAGNLTSRGYGRIIADH
Ligand information
>6h9h Chain E (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucgguguuccccgcgccgcgggg
.........<<<<<<<.>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h9h Type IV CRISPR RNA processing and effector complex formation in Aromatoleum aromaticum.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		R8 W18 H44 A45 I46 T47 R48 K54 R55 S89 S90 W92 F146 R148 N149 K153 R154 L156 K158 R169 R176 R200 P201 R202 G203 M204 L206 T208 T213 E214 Q215 F216 N238 L239 S241 R242 Y244 R246 I248 H251
Binding residue
(residue number reindexed from 1)		R7 W17 H43 A44 I45 T46 R47 K53 R54 S88 S89 W91 F145 R147 N148 K152 R153 L155 K157 R168 R175 R199 P200 R201 G202 M203 L205 T207 T212 E213 Q214 F215 N237 L238 S240 R241 Y243 R245 I247 H250
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6h9h, PDBe:6h9h, PDBj:6h9h
PDBsum6h9h
PubMed30397343
UniProtQ5NWP0

[Back to BioLiP]