Structure of PDB 6gvu Chain B Binding Site BS01

Receptor Information
>6gvu Chain B (length=115) Species: 43080 (Sulfolobus islandicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVVEFEELRKELVKRDSGKPVEKIKEEICTKSPPKLIKEIICENKTYADV
NIDRSRGDWHVILYLMKHGVTDPDKILELLPRDSKAKENEKWNTQKYFVI
TLSKAWSVVKKYLEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gvu A Small Helical Bundle Prepares Primer Synthesis by Binding Two Nucleotides that Enhance Sequence-Specific Recognition of the DNA Template.
ResolutionN/A
Binding residue
(original residue number in PDB)		S310 R311 W314 H315 L318 K340 W347 N348 K351 Y352 K359
Binding residue
(residue number reindexed from 1)		S55 R56 W59 H60 L63 K85 W92 N93 K96 Y97 K104
Enzymatic activity
Enzyme Commision number ?
External links