Structure of PDB 6gts Chain B Binding Site BS01

Receptor Information
>6gts Chain B (length=71) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAVKKQRIDLRLTDDDKSMIEEAAAISNQSVSQFMLNSASQRAAEVIEQH
RRVILNEESWTRVMDALSNPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gts Mechanism of regulation and neutralization of the AtaR-AtaT toxin-antitoxin system.
Resolution3.357 Å
Binding residue
(original residue number in PDB)		K6 S31 V32 S33 Q34
Binding residue
(residue number reindexed from 1)		K5 S30 V31 S32 Q33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0097351 toxin sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6gts, PDBe:6gts, PDBj:6gts
PDBsum6gts
PubMed30718814
UniProtJ7QA90

[Back to BioLiP]