Structure of PDB 6gpz Chain B Binding Site BS01

Receptor Information
>6gpz Chain B (length=62) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEEL
QQENLQLKKQLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gpz The cell cycle regulator GpsB functions as cytosolic adaptor for multiple cell wall enzymes.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
L14 K16 D31 L34 D35
Binding residue
(residue number reindexed from 1)
L13 K15 D30 L33 D34
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6gpz, PDBe:6gpz, PDBj:6gpz
PDBsum6gpz
PubMed30651563
UniProtP0CI74|GPSB_BACSU Cell cycle protein GpsB (Gene Name=gpsB)

[Back to BioLiP]