Structure of PDB 6gp7 Chain B Binding Site BS01

Receptor Information
>6gp7 Chain B (length=59) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQE
NLQLKKQLE
Ligand information
>6gp7 Chain D (length=11) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FNSREARRKAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gp7 The cell cycle regulator GpsB functions as cytosolic adaptor for multiple cell wall enzymes.
Resolution1.95002 Å
Binding residue
(original residue number in PDB)		I13 L14 K16 E17 Q27 E28 D31 L34 D35
Binding residue
(residue number reindexed from 1)		I9 L10 K12 E13 Q23 E24 D27 L30 D31
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6gp7, PDBe:6gp7, PDBj:6gp7
PDBsum6gp7
PubMed30651563
UniProtP0CI74|GPSB_BACSU Cell cycle protein GpsB (Gene Name=gpsB)

[Back to BioLiP]