Structure of PDB 6gmg Chain B Binding Site BS01

Receptor Information

>6gmg Chain B (length=330) Species: 1223523 (Streptomyces mobaraensis NBRC 13819 = DSM 40847) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDDRVTPPAEPLDRMPDPYRPSYGRAETVVNNYIRKWQQVYSHRDGRKQQ
MTEEQREWLSYGCVGVTWVNSGQYPTNRLAFASFDEDRFKNELKNGRPRS
GETRAEFEGRVAKESFDEEKGFQRAREVASVMNRALENAHDESAYLDNLK
KELANGNDALRNEDARSPFYSALRNTPSFKERNGGNHDPSRMKAVIYSKH
FWSGQDRSSSADKRKYGDPDAFRPAPGTGLVDMSRDRNIPRSPTSPGEGF
VNFDYGWFGAQTEADADKTVWTHGNHYHAPNGSLGAMHVYESKFRNWSEG
YSDFDRGAYVITFIPKSWNTAPDKVKQGWP

Ligand information

>6gmg Chain D (length=9) Species: 35621 (Streptomyces mobaraensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DIPIGSKMT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6gmg Structure of a glutamine donor mimicking inhibitory peptide shaped by the catalytic cleft of microbial transglutaminase.
Resolution	2.25 Å
Binding residue (original residue number in PDB)	Y62 G63 C64 G250 F254 N276 H277 Y278 L285
Binding residue (residue number reindexed from 1)	Y61 G62 C63 G249 F253 N275 H276 Y277 L284

Enzymatic activity

Catalytic site (original residue number in PDB)	C64 D255 W272 H274
Catalytic site (residue number reindexed from 1)	C63 D254 W271 H273
Enzyme Commision number	?

Gene Ontology

	Molecular Function
GO:0003810	protein-glutamine gamma-glutamyltransferase activity

View graph for
Molecular Function

External links

PDB	RCSB:6gmg, PDBe:6gmg, PDBj:6gmg
PDBsum	6gmg
PubMed	30318745
UniProt	M3C567

[Back to BioLiP]