Structure of PDB 6g99 Chain B Binding Site BS01

Receptor Information

>6g99 Chain B (length=41) Species: 9606 (Homo sapiens)

GPLGSGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDG

Ligand information

>6g99 Chain A (length=5)

uggug

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6g99 The Solution Structure of FUS Bound to RNA Reveals a Bipartite Mode of RNA Recognition with Both Sequence and Shape Specificity.
• Resolution: N/A
• Binding residue (original residue number in PDB): S418 G419 Q420 Q421 R422 D425 N435 M436 N437 F438 S439 W440 R441 N445
• Binding residue (residue number reindexed from 1): S5 G6 Q7 Q8 R9 D12 N22 M23 N24 F25 S26 W27 R28 N32
• Binding affinity: PDBbind-CN: Kd=29.5uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:6g99, PDBe:6g99, PDBj:6g99
• PDBsum: 6g99
• PubMed: 30581145
• UniProt: P35637|FUS_HUMAN RNA-binding protein FUS (Gene Name=FUS)