Structure of PDB 6fzt Chain B Binding Site BS01

Receptor Information
>6fzt Chain B (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCP
GQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLEC
CEFPFGSKQKEVCINPYHYRRVETPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fzt Unveiling the dimer/monomer propensities of Smad MH1-DNA complexes
Resolution2.46 Å
Binding residue
(original residue number in PDB)
R75 H102
Binding residue
(residue number reindexed from 1)
R66 H93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6fzt, PDBe:6fzt, PDBj:6fzt
PDBsum6fzt
PubMed
UniProtO15198|SMAD9_HUMAN Mothers against decapentaplegic homolog 9 (Gene Name=SMAD9)

[Back to BioLiP]