Structure of PDB 6fqp Chain B Binding Site BS01

Receptor Information
>6fqp Chain B (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCN
WFINARRRLLPDMLRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fqp TGIF1 homeodomain interacts with Smad MH1 domain and represses TGF-beta signaling.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		R165 R166 R167 R168 G169 Y191 K197 I216 R219 R220
Binding residue
(residue number reindexed from 1)		R2 R3 R4 R5 G6 Y28 K34 I53 R56 R57
Binding affinityPDBbind-CN: Kd=169.9nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6fqp, PDBe:6fqp, PDBj:6fqp
PDBsum6fqp
PubMed30060237
UniProtQ15583|TGIF1_HUMAN Homeobox protein TGIF1 (Gene Name=TGIF1)

[Back to BioLiP]