Structure of PDB 6fhu Chain B Binding Site BS01

Receptor Information
>6fhu Chain B (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLA
Q
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fhu Targeting Ligandable Pockets on Plant Homeodomain (PHD) Zinc Finger Domains by a Fragment-Based Approach.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D1688 L1691 L1693 P1714 G1716
Binding residue
(residue number reindexed from 1)		D13 L16 L18 P39 G41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6fhu, PDBe:6fhu, PDBj:6fhu
PDBsum6fhu
PubMed29529862
UniProtQ9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A (Gene Name=BAZ2A)

[Back to BioLiP]