Structure of PDB 6fey Chain B Binding Site BS01

Receptor Information
>6fey Chain B (length=207) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRS
ELDDLDSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRS
SRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLN
NENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFV
YPVLNEE
Ligand information
>6fey Chain E (length=21) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVVDSCCRNSCSFSTLRAYCD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fey Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
Resolution3.48 Å
Binding residue
(original residue number in PDB)		F28 S120
Binding residue
(residue number reindexed from 1)		F3 S86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043559 insulin binding
GO:0098632 cell-cell adhesion mediator activity
Biological Process
GO:0007155 cell adhesion
GO:0007156 homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007411 axon guidance
GO:0008340 determination of adult lifespan
GO:0009625 response to insect
GO:0010888 negative regulation of lipid storage
GO:0042594 response to starvation
GO:0046627 negative regulation of insulin receptor signaling pathway
GO:0046628 positive regulation of insulin receptor signaling pathway
GO:0061965 positive regulation of entry into reproductive diapause
GO:0070593 dendrite self-avoidance
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005886 plasma membrane
GO:0030424 axon

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fey, PDBe:6fey, PDBj:6fey
PDBsum6fey
PubMed30242155
UniProtQ09024|IMPL2_DROME Neural/ectodermal development factor IMP-L2 (Gene Name=ImpL2)

[Back to BioLiP]