Structure of PDB 6fb9 Chain B Binding Site BS01

Receptor Information
>6fb9 Chain B (length=153) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fb9 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		S232 Y233 K234 Q238 R268 R270 E280 I281 K316 K339
Binding residue
(residue number reindexed from 1)		S31 Y32 K33 Q37 R67 R69 E79 I80 K115 K138
Enzymatic activity
Catalytic site (original residue number in PDB) G219 D220
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fb9, PDBe:6fb9, PDBj:6fb9
PDBsum6fb9
PubMed29980759
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]