Structure of PDB 6fb5 Chain B Binding Site BS01

Receptor Information
>6fb5 Chain B (length=154) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSGKFKHKLSLTFKVTQKTQR
RWFLDKLVDEIGVGYVYDSGSVSNYYLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQVAALNDSKTRKTTSETVRAV
LDSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fb5 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		S32 G33 K38 Y66 Y68 S70 Y77 I81 K116 D137 K139
Binding residue
(residue number reindexed from 1)		S31 G32 K37 Y65 Y67 S69 Y76 I80 K115 D136 K138
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fb5, PDBe:6fb5, PDBj:6fb5
PDBsum6fb5
PubMed29980759
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]