Structure of PDB 6fb0 Chain B Binding Site BS01

Receptor Information
>6fb0 Chain B (length=154) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSGKFKHKLSLTFKVTQKTQR
RWFLDKLVDEIGVGYVYDSGSVSNYYLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQVAALNDSKTRKTTSETVRAV
LDSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fb0 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		K38 Y66 Y68 I81 K116 D137 K139
Binding residue
(residue number reindexed from 1)		K37 Y65 Y67 I80 K115 D136 K138
Binding affinityPDBbind-CN: Kd=100nM
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fb0, PDBe:6fb0, PDBj:6fb0
PDBsum6fb0
PubMed29980759
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]