Structure of PDB 6fas Chain B Binding Site BS01

Receptor Information
>6fas Chain B (length=110) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNLNIVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQD
VRGREWTFQFRYWPNNNSRMYVLEGVTPCIQSMMLQAGDTVTFSRVDPGG
KLIMGSRKAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fas Structural basis of DNA target recognition by the B3 domain of Arabidopsis epigenome reader VAL1.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K297 S300 S302 V311 P313 K314 N351 S354 M356
Binding residue
(residue number reindexed from 1)		K11 S14 S16 V25 P27 K28 N65 S68 M70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6fas, PDBe:6fas, PDBj:6fas
PDBsum6fas
PubMed29660015
UniProtQ8W4L5|VAL1_ARATH B3 domain-containing transcription repressor VAL1 (Gene Name=VAL1)

[Back to BioLiP]