Structure of PDB 6f58 Chain B Binding Site BS01

Receptor Information

>6f58 Chain B (length=175) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYS
FLLDFVAADNHRWKYVNGEWVPGAPSCVYIHPDSPNFGAHWMKAPVSFSK
VKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAV
TAYQNEEITALKIKYNPFAKAFLDA

Ligand information

>6f58 Chain C (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aatttcacacctaggtgtgaaatt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6f58 Crystal structure of human Brachyury (T) in complex with DNA
Resolution	2.253 Å
Binding residue (original residue number in PDB)	R69 R70 K147 Y198 T204 N211 F213 F217
Binding residue (residue number reindexed from 1)	R30 R31 K102 Y153 T159 N166 F168 F172

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6f58, PDBe:6f58, PDBj:6f58
PDBsum	6f58
PubMed
UniProt	O15178\|TBXT_HUMAN T-box transcription factor T (Gene Name=TBXT)

[Back to BioLiP]