Structure of PDB 6f4g Chain B Binding Site BS01

Receptor Information
>6f4g Chain B (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKM
RGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAK
Ligand information
>6f4g Chain C (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggccguauugcaguaccgcggcc
..<<<<<<...........>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f4g Molecular principles underlying dual RNA specificity in the Drosophila SNF protein.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y10 N12 N13 E16 K17 K20 K24 V41 A42 L43 K44 K47 M48 R49 Q51 F53 K77 S84 K85 S86 D87 S88 D89
Binding residue
(residue number reindexed from 1)		Y12 N14 N15 E18 K19 K22 K26 V43 A44 L45 K46 K49 M50 R51 Q53 F55 K79 S86 K87 S88 D89 S90 D91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6f4g, PDBe:6f4g, PDBj:6f4g
PDBsum6f4g
PubMed29880797
UniProtP43332|SNRPA_DROME U1 small nuclear ribonucleoprotein A (Gene Name=snf)

[Back to BioLiP]