Structure of PDB 6f2s Chain B Binding Site BS01

Receptor Information

>6f2s Chain B (length=195) Species: 44560 (Ageratum yellow vein virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PDVPKGCEGPCKVQSYEQRHDISHVGKVLCVSDVTRGNGLTHRVGKRFCV
KSVYVLGKIWMDENIKTKNHTNTVMFYLVRDRRPFGTAMDFGQVFNMYDN
EPSTATIKNDLRDRYQVLRKFTSTVTGGQYASKEQALVKKFMKINNYVVY
NHQEAAKYDNHTENALLLYMACTHASNPVYATLKIRIYFYDSVQN

Ligand information

>6f2s Chain M (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caaccac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6f2s The 3.3 angstrom structure of a plant geminivirus using cryo-EM.
Resolution	3.3 Å
Binding residue (original residue number in PDB)	C73 K113 Y116 F203 R248 Y250
Binding residue (residue number reindexed from 1)	C11 K51 Y54 F141 R186 Y188

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6f2s, PDBe:6f2s, PDBj:6f2s
PDBsum	6f2s
PubMed	29915210
UniProt	W5RUR4

[Back to BioLiP]