Structure of PDB 6f0g Chain B Binding Site BS01

Receptor Information
>6f0g Chain B (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWE
Ligand information
>6f0g Chain D (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STERKWAELARRIRGAGGVTLNGF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f0g Design on a Rational Basis of High-Affinity Peptides Inhibiting the Histone Chaperone ASF1.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		V6 N8 V9 A48 E51 D54 V94 L96 R108 Y112 N143 P144 R145 V146 T147 R148 F149
Binding residue
(residue number reindexed from 1)		V6 N8 V9 A48 E51 D54 V94 L96 R108 Y112 N143 P144 R145 V146 T147 R148 F149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6f0g, PDBe:6f0g, PDBj:6f0g
PDBsum6f0g
PubMed31543461
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]