Structure of PDB 6efk Chain B Binding Site BS01

Receptor Information
>6efk Chain B (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLK
MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYS
LAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6efk Specificity for latent C termini links the E3 ubiquitin ligase CHIP to caspases.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
K30 N34 F37 Y49 N65 L68 K95 F98 F99 F131 D134
Binding residue
(residue number reindexed from 1)
K8 N12 F15 Y27 N43 L46 K73 F76 F77 F109 D112
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:6efk, PDBe:6efk, PDBj:6efk
PDBsum6efk
PubMed31320752
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]