Structure of PDB 6e86 Chain B Binding Site BS01

Receptor Information
>6e86 Chain B (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHET
DIHKEDHQLEPIYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e86 The ZZ-type zinc finger of ZZZ3 modulates the ATAC complex-mediated histone acetylation and gene activation.
ResolutionN/A
Binding residue
(original residue number in PDB)		G820 F821 K822 D824 E844 S846 D848
Binding residue
(residue number reindexed from 1)		G10 F11 K12 D14 E34 S36 D38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:6e86, PDBe:6e86, PDBj:6e86
PDBsum6e86
PubMed30217978
UniProtQ8IYH5|ZZZ3_HUMAN ZZ-type zinc finger-containing protein 3 (Gene Name=ZZZ3)

[Back to BioLiP]