Structure of PDB 6e5n Chain B Binding Site BS01

Receptor Information
>6e5n Chain B (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTIN
TSCDIELLAACREEFHRRLKVYHAWKSKNKKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e5n Clathrin light chain A drives selective myosin VI recruitment to clathrin-coated pits under membrane tension.
ResolutionN/A
Binding residue
(original residue number in PDB)		M1053 P1055 M1058 M1062 S1087 K1090 Y1091 R1117 V1120 Y1121 W1124 N1128
Binding residue
(residue number reindexed from 1)		M4 P6 M9 M13 S38 K41 Y42 R68 V71 Y72 W75 N79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6e5n, PDBe:6e5n, PDBj:6e5n
PDBsum6e5n
PubMed31672988
UniProtQ9UM54|MYO6_HUMAN Unconventional myosin-VI (Gene Name=MYO6)

[Back to BioLiP]